DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and Hsd17b11

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_444492.1 Gene:Hsd17b11 / 114664 MGIID:2149821 Length:298 Species:Mus musculus


Alignment Length:285 Identity:87/285 - (30%)
Similarity:147/285 - (51%) Gaps:19/285 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LIGLAAITPLLILVALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVV 82
            |:.|..:.||||:.::  ..:.||......||:|||:.::||||||:||..:.|.||....:.:.
Mouse     4 LLDLILLLPLLIVFSI--ESLVKLFIPKKKKSVAGEIVLITGAGHGIGRLTAYEFAKLNTKLVLW 66

  Fly    83 DINVSGAEDTVKQIQDIYKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMF 147
            |||.:|.|:|..:.:.: ..:|..:..:.:..:::.....||.||:|.|::|||||||:...::|
Mouse    67 DINKNGIEETAAKCRKL-GAQAHPFVVDCSQREEIYSAAKKVKEEVGDVSILVNNAGVVYTADLF 130

  Fly   148 NPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAH 212
            ......::....||:.:||||...|||.|.:...|.|||::|.||...:|:...|.::|..|:..
Mouse   131 ATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGHIVTVASAAGHTVVPFLLAYCSSKFAAVGF 195

  Fly   213 MRTLRMELDLENQKDIHVTTVLPSFLRTNSDVTQLTHTIGF-----GDVYPLFTGEEVAQRIVAG 272
            .|.|..||....:..:..:.:.|:|:.|           ||     .::.|....|||.:.::.|
Mouse   196 HRALTDELAALGRTGVRTSCLCPNFINT-----------GFIKNPSTNLGPTLEPEEVVEHLMHG 249

  Fly   273 MVRGEAEITVPGMACLLYRVILILP 297
            ::..:..|.||....||..:..|:|
Mouse   250 ILTEKQMIFVPSSIALLTVLERIVP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 60/187 (32%)
NADB_Rossmann 54..297 CDD:304358 73/247 (30%)
Hsd17b11NP_444492.1 adh_short 37..228 CDD:278532 63/202 (31%)
17beta-HSDXI-like_SDR_c 38..277 CDD:187598 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.