DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and ZIC4

DIOPT Version :9

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001161850.1 Gene:ZIC4 / 84107 HGNCID:20393 Length:384 Species:Homo sapiens


Alignment Length:233 Identity:97/233 - (41%)
Similarity:123/233 - (52%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 LICRWTG---------CDEEFPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLL 490
            |||:|..         |.:.|......|.|:...||...:..:..|||.:|||:.|||.|:|||:
Human   178 LICKWLAADGTATPSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLV 242

  Fly   491 IHMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRT 555
            .|:|||:||||..||||||.|.|:|.||||||:|:||||:|:.|:::||.:.|:|||||.||...
Human   243 NHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHV 307

  Fly   556 HYDTKPYACQLPGCTKRYTDPSSLRKHVKNHALRNANGQLRRKSAGGASVPPSGPKKAAKTRRHS 620
            |...|||.|::.||.|.||.|||||||:|.|               |.|.|||            
Human   308 HTSDKPYTCKVRGCDKCYTHPSSLRKHMKVH---------------GRSPPPS------------ 345

  Fly   621 ESALVQRGVGAGVGVAVPSA---PGDQRQHRSNSCSEA 655
                      :|...|.|||   |.....|:|...|.|
Human   346 ----------SGYDSATPSALVSPSSDCGHKSQVASSA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 17/25 (68%)
C2H2 Zn finger 504..526 CDD:275368 16/21 (76%)
C2H2 Zn finger 534..556 CDD:275368 11/21 (52%)
C2H2 Zn finger 564..586 CDD:275368 14/21 (67%)
ZIC4NP_001161850.1 COG5048 <192..338 CDD:227381 77/145 (53%)
C2H2 Zn finger 228..248 CDD:275368 12/19 (63%)
zf-H2C2_2 241..267 CDD:290200 17/25 (68%)
C2H2 Zn finger 256..278 CDD:275368 16/21 (76%)
zf-H2C2_2 270..297 CDD:290200 15/26 (58%)
C2H2 Zn finger 286..308 CDD:275368 11/21 (52%)
zf-C2H2 314..338 CDD:278523 15/23 (65%)
C2H2 Zn finger 316..338 CDD:275368 14/21 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D268347at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19818
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.