DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and ELF6

DIOPT Version :9

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_196044.2 Gene:ELF6 / 830303 AraportID:AT5G04240 Length:1340 Species:Arabidopsis thaliana


Alignment Length:371 Identity:77/371 - (20%)
Similarity:129/371 - (34%) Gaps:93/371 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 NVFEEQVKEEASPAKLPSMNSTFGTPKCIPMCASNYEDYANLYQQGSGYSTENYHNNMAQVVEKP 312
            |:.:||..:...|.:   ..:.||.                 ::|..|....:...|:...:.. 
plant  1018 NIEDEQQSQIVKPTQ---REAVFGD-----------------HEQVEGAEAVSTRENLCSEIIL- 1061

  Fly   313 NREHKAIWTIDELDELMLGEQQQFLQHHLQQQHLQEQQEQLHQPHGQEQQTQNCKDDLVNYLSDE 377
            :.||.:.....|:.::....:...:......:.| |..:.|...:|.|..:..     :..|:||
plant  1062 HTEHSSAHVGMEIPDINTASENLVVDMTHDGEPL-ESSDILSSSNGDEASSNG-----LQVLNDE 1120

  Fly   378 FI---------------------KAEEFRSLDSDDDENYNEEEDDLDNDVFAPPAE---SDPKPD 418
            ..                     :|::.|.::|:.:.|.|.|.   .......|.|   |..|..
plant  1121 LSMESEVSSSENTEVIEAPNSMGEAKKKRKIESESETNDNPES---SIGFIRSPCEGLRSRGKRK 1182

  Fly   419 STC---------CDPEAEP---ENEVIPLICRWTGCDEEFPHQQAFVEHIEKCHVDVRKGEDFSC 471
            :||         .|.|.:|   ..:..|..|..:. .:|.|    ...|..:|:::..|      
plant  1183 ATCETSLKHTETSDEEKKPIAKRLKKTPKACSGSR-QQEVP----TTTHPNRCYLEGCK------ 1236

  Fly   472 FWLDCPRRYKPFNARYKLLIHMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQY 536
                     ..|.::.||..|.|       |:|...||.|.|...:.|.:|||.|..|||:.|.:
plant  1237 ---------MTFESKAKLQTHKR-------NRCTHEGCGKKFRAHKYLVLHQRVHKDERPFECSW 1285

  Fly   537 KGCLKAFSNSSDRAKHQRTHYDTKPYACQLPGCTKRYTDPSSLRKH 582
            |||...|.....|.:|.|.|...:||.|::.||...:...|...:|
plant  1286 KGCSMTFKWQWARTEHLRLHTGERPYICKVDGCGLSFRFVSDYSRH 1331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 9/25 (36%)
C2H2 Zn finger 504..526 CDD:275368 9/21 (43%)
C2H2 Zn finger 534..556 CDD:275368 8/21 (38%)
C2H2 Zn finger 564..586 CDD:275368 5/19 (26%)
ELF6NP_196044.2 JmjN 17..50 CDD:396793
JmjC 292..411 CDD:396791
C2H2 Zn finger 1230..1255 CDD:275368 9/46 (20%)
C2H2 Zn finger 1253..1275 CDD:275368 9/21 (43%)
C2H2 Zn finger 1283..1305 CDD:275368 8/21 (38%)
C2H2 Zn finger 1313..1333 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.