DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and ZXDA

DIOPT Version :9

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_009087.1 Gene:ZXDA / 7789 HGNCID:13198 Length:799 Species:Homo sapiens


Alignment Length:439 Identity:111/439 - (25%)
Similarity:170/439 - (38%) Gaps:100/439 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 EPENEVIPLICRWTGCDEEFPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLLI 491
            |||.   |..|.::||.:.|....|...| .:.|  .|:.|.|||.:..|.::|   :...:|.|
Human   384 EPER---PYQCAFSGCKKTFITVSALFSH-NRAH--FREQELFSCSFPGCSKQY---DKACRLKI 439

  Fly   492 HMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTH 556
            |:|.|:||:|..|.|.||...|:.:..|..|:|.|..:|.:.|..:||.|:|:.:.....|..||
Human   440 HLRSHTGERPFLCDFDGCGWNFTSMSKLLRHKRKHDDDRRFMCPVEGCGKSFTRAEHLKGHSITH 504

  Fly   557 YDTKPYACQLPGCTKRYTDPSSLRKHVKNHALRNANGQLRRKSAGGASVPPSGPKKAAKTRRHSE 621
            ..|||:.|.:.||..|::..|||..|.|.|        |:......:..|.|...|...::...:
Human   505 LGTKPFVCPVAGCCARFSARSSLYIHSKKH--------LQDVDTWKSRCPISSCNKLFTSKHSMK 561

  Fly   622 SALVQR-GVG--------AGVGVAVPSAPGDQRQHR-------------SNSCSEALL------- 657
            :.:|:| .||        |...:...|....|||:.             .:|.|.|||       
Human   562 THMVKRHKVGQDLLAQLEAANSLTPSSELTSQRQNDLSDAEIVSLFSDVPDSTSAALLDTALVNS 626

  Fly   658 -------------LQQHQQQQQQQQQQQKQHQPENERTTD-----RSNCGTGVAA---NNNSMNF 701
                         |..|..........|....|....|:|     .::...|.||   ..:|:|.
Human   627 GILTIDVASVSSTLAGHLPANNNNSVGQAVDPPSLMATSDPPQSLDTSLFFGTAATGFQQSSLNM 691

  Fly   702 NELSNCIVIIEHNQSGGPAG-------------PATLATATATTTATATY-GNGNMAPAPETEVL 752
            :|:|:..|        ||.|             |..|..::..|..|.|. .:..:.....:|:|
Human   692 DEVSSVSV--------GPLGSLDSLAMKNSSPEPQALTPSSKLTVDTDTLTPSSTLCENSVSELL 748

  Fly   753 SVCSGGGSSNSNSN------NNRY---NANINQLSELEQLLTTAKPTGT 792
            :......|.:.||:      ..::   ||..|..|:.|:.|.|.  ||:
Human   749 TPAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITV--TGS 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 13/25 (52%)
C2H2 Zn finger 504..526 CDD:275368 8/21 (38%)
C2H2 Zn finger 534..556 CDD:275368 6/21 (29%)
C2H2 Zn finger 564..586 CDD:275368 9/21 (43%)
ZXDANP_009087.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89
Required for interaction with ZXDC. /evidence=ECO:0000269|PubMed:17493635 267..573 65/205 (32%)
C2H2 Zn finger 269..291 CDD:275368
zf-C2H2_aberr 300..445 CDD:293622 22/69 (32%)
zf-C2H2 300..324 CDD:278523
C2H2 Zn finger 302..324 CDD:275368
C2H2 Zn finger 332..354 CDD:275368
zf-H2C2_2 346..369 CDD:290200
C2H2 Zn finger 362..382 CDD:275368
C2H2 Zn finger 391..413 CDD:275368 6/22 (27%)
C2H2 Zn finger 425..444 CDD:275368 6/21 (29%)
COG5048 <437..568 CDD:227381 44/138 (32%)
C2H2 Zn finger 452..474 CDD:275368 8/21 (38%)
zf-H2C2_2 467..493 CDD:290200 10/25 (40%)
C2H2 Zn finger 482..504 CDD:275368 6/21 (29%)
C2H2 Zn finger 512..534 CDD:275370 9/21 (43%)
Required for transcriptional activation 572..699 23/126 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.