DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and sp9

DIOPT Version :10

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_998125.2 Gene:sp9 / 405896 ZFINID:ZDB-GENE-040426-2313 Length:447 Species:Danio rerio


Alignment Length:190 Identity:61/190 - (32%)
Similarity:78/190 - (41%) Gaps:49/190 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 DCP-----RRYKPFNARYKLLIHMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGC 534
            |||     .|..|..|.   |....:||      |..|||.|.:.:..:||.|.|.||||||:.|
Zfish   293 DCPNCQEAERLGPAGAS---LRRKGLHS------CHIPGCGKVYGKTSHLKAHLRWHTGERPFVC 348

  Fly   535 QYKGCLKAFSNSSDRAKHQRTHYDTKPYACQLPGCTKRYTDPSSLRKHVKNHALRNANGQLRRKS 599
            .:..|.|.|:.|.:..:|.|||...|.:||  |.|.||:.....|.||:|.|            :
Zfish   349 NWLFCGKRFTRSDELQRHLRTHTGEKRFAC--PVCNKRFMRSDHLSKHIKTH------------T 399

  Fly   600 AGGASVPPSGPKKAA---------KTRRHSESALVQRGVGAGVGVAVPSAPGDQRQHRSN 650
            |||      |.||.:         :|.|.....|:..||...|.|.      ||..|..:
Zfish   400 AGG------GGKKGSDSDTDTSNLETPRSESPELILEGVNPRVTVK------DQSPHHES 447

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 SFP1 <493..585 CDD:227516 36/91 (40%)
C2H2 Zn finger 504..526 CDD:275368 9/21 (43%)
C2H2 Zn finger 534..556 CDD:275368 7/21 (33%)
C2H2 Zn finger 564..586 CDD:275368 9/21 (43%)
sp9NP_998125.2 SP9_N 27..317 CDD:411695 7/26 (27%)