DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and sp6

DIOPT Version :10

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_991195.1 Gene:sp6 / 402928 ZFINID:ZDB-GENE-040426-1824 Length:278 Species:Danio rerio


Alignment Length:115 Identity:35/115 - (30%)
Similarity:56/115 - (48%) Gaps:2/115 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   502 NKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTHYDTKPYACQL 566
            :.|..|||.||:.:..:||.|.|.|:|:||:.|.:..|.|.|:.|.:..:|.:||...|.:.|. 
Zfish   152 HNCHIPGCGKAYVKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGAKRFGCS- 215

  Fly   567 PGCTKRYTDPSSLRKHVKNHALRNANGQLRRKSAGGASVPPSGPKKAAKT 616
             .|.:.:.....|.||::.|...:.:.:....:|.|.|...|......||
Zfish   216 -SCPRVFLRADHLAKHMRVHESPSQSTEETHAAAAGTSTGTSSALLRVKT 264

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 SFP1 <493..585 CDD:227516 28/82 (34%)
C2H2 Zn finger 504..526 CDD:275368 10/21 (48%)
C2H2 Zn finger 534..556 CDD:275368 6/21 (29%)
C2H2 Zn finger 564..586 CDD:275368 5/21 (24%)