DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and zic3

DIOPT Version :9

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001001950.1 Gene:zic3 / 368263 ZFINID:ZDB-GENE-030708-2 Length:448 Species:Danio rerio


Alignment Length:445 Identity:133/445 - (29%)
Similarity:185/445 - (41%) Gaps:95/445 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 LGEISAAASSSAASPKLGNVFEEQVKEEASPAKLPSMNSTFGTPKCIPMCAS---NYEDYANLYQ 291
            ||....|.||.:|:.|:..|..:...         |..|.| ||:.....|:   ::......|.
Zfish    34 LGLSPFADSSHSAAFKISPVTHDIAS---------SQTSAF-TPQATGYAAALGHHHGGQVGSYA 88

  Fly   292 QGSGYSTEN--YHNNMAQVVE--KPNREHKAIWTI------------DELDELML-GEQQQFLQH 339
            .|:..||.:  :.|..|.:.|  .|:.:| .|:..            |....|:. |...|.:.|
Zfish    89 GGAFNSTRDFLFRNRGAGIGETAPPSAQH-GIFAASAGSLHGPPGISDNPGHLLFPGLHDQSVSH 152

  Fly   340 HLQQQHLQEQQEQLHQPHGQEQQTQNCKDDLVNYLSDEFIKAEEFRSLDSDDDENYNEEEDDLDN 404
            .....|:...|..|                  ....|.|.:.:.:|.:.|...|.|.        
Zfish   153 TSPGGHVVNSQMHL------------------GLRGDIFGRPDPYRPVASPRTEPYG-------- 191

  Fly   405 DVFAPPAESDPKPDS--------TCCDPEA------EPENEVIPLICRWTG----------CDEE 445
               |.|..:...|.:        |...|.|      :|..:  .|.|:|..          ||..
Zfish   192 ---AAPLHNYNHPINMNMGMNVPTHHGPGAFFRYMRQPIKQ--ELSCKWIDENQMNRPKKTCDRT 251

  Fly   446 FPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLLIHMRVHSGEKPNKCPFPGCN 510
            |......|.|:...||...:..:..|:|.||||..|.|.|:|||:.|:|||:||||..||||||.
Zfish   252 FSTMHEMVTHVSMEHVGGPEQSNHVCYWEDCPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCG 316

  Fly   511 KAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTHYDTKPYACQLPGCTKRYTD 575
            |.|:|.||||||:|:||||:|:.|::.||.:.|:|||||.||...|...|||.|::  |.|.||.
Zfish   317 KIFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTH 379

  Fly   576 PSSLRKHVKNHALRNANGQLRRKSAGGASVPP-------SGPKKAAKTRRHSESA 623
            |||||||:|.|..:.:.......|...:|.||       ..|.|...:...:.||
Zfish   380 PSSLRKHMKVHESQGSESSPAASSGYESSTPPVLVSANTEDPTKTPTSAVQNSSA 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 17/25 (68%)
C2H2 Zn finger 504..526 CDD:275368 16/21 (76%)
C2H2 Zn finger 534..556 CDD:275368 11/21 (52%)
C2H2 Zn finger 564..586 CDD:275368 13/21 (62%)
zic3NP_001001950.1 C2H2 Zn finger 282..302 CDD:275368 11/19 (58%)
zf-H2C2_2 295..321 CDD:290200 17/25 (68%)
C2H2 Zn finger 310..332 CDD:275368 16/21 (76%)
zf-H2C2_2 324..351 CDD:290200 15/26 (58%)
C2H2 Zn finger 340..362 CDD:275368 11/21 (52%)
zf-H2C2_2 354..379 CDD:290200 12/26 (46%)
zf-C2H2 368..390 CDD:278523 14/23 (61%)
C2H2 Zn finger 370..390 CDD:275368 13/21 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19818
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.