DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and Zic5

DIOPT Version :9

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001382593.1 Gene:Zic5 / 361095 RGDID:1310160 Length:623 Species:Rattus norvegicus


Alignment Length:313 Identity:112/313 - (35%)
Similarity:140/313 - (44%) Gaps:69/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 APPAESDPKPDSTCCDPEAEPENEVIP-----------------LICRWTG-------------- 441
            |||....|.       |...|.:..:|                 |||:|..              
  Rat   330 APPPAPPPA-------PAPHPHHPHLPGAAGAFLRYMRQPIKRELICKWLDPEELAGPPAPADSG 387

  Fly   442 ---CDEEFPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLLIHMRVHSGEKPNK 503
               |.:.|......|.|:...||...:.....|||.||||..|||.|:|||:.|:|||:||||..
  Rat   388 AKPCSKTFGTMHELVNHVTVEHVGGPEQSSHVCFWEDCPREGKPFKAKYKLINHIRVHTGEKPFP 452

  Fly   504 CPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTHYDTKPYACQLPG 568
            ||||||.|.|:|.||||||:|:||||:|:.|::.||.:.|:|||||.||...|...|||.|::.|
  Rat   453 CPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKIRG 517

  Fly   569 CTKRYTDPSSLRKHVKNHALRNANGQLRRKSAGGASVPPSGPKKAAKTRRHSESALVQRGVGAGV 633
            |.|.||.|||||||:|.|.          ||      ||..|           .||....||..|
  Rat   518 CDKSYTHPSSLRKHMKIHC----------KS------PPPSP-----------GALGYSSVGTPV 555

  Fly   634 GVAVPSAPGDQRQHRSNSCSEALLLQQHQQQQQQQQQQQKQHQPENERTTDRS 686
            |..: |...|..:.||::.|..:.........|........|.|.:..||..|
  Rat   556 GDTL-SPVLDPTRSRSSTLSPQVTNLNEWYVCQAGGAPSHLHTPSSNGTTSES 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 17/25 (68%)
C2H2 Zn finger 504..526 CDD:275368 16/21 (76%)
C2H2 Zn finger 534..556 CDD:275368 11/21 (52%)
C2H2 Zn finger 564..586 CDD:275368 14/21 (67%)
Zic5NP_001382593.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D268347at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.