DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and iec1

DIOPT Version :9

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_594663.1 Gene:iec1 / 2542854 PomBaseID:SPAC144.02 Length:249 Species:Schizosaccharomyces pombe


Alignment Length:126 Identity:39/126 - (30%)
Similarity:62/126 - (49%) Gaps:23/126 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 EAEPENEVIPLICRWTGCDEEFPHQQAFVEHIEK----------------CHVDVRKGEDFSCFW 473
            :.|||:|.   ||.|..|:::.......|.||..                .|:..|:.: ::|.|
pombe    17 DLEPESET---ICHWQSCEQDLLTLDNLVHHIHNGTTSNLRLISNINSILDHIGNRRPK-YTCEW 77

  Fly   474 LDCPRRYKPFNARYKLLIHMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRS-HTGE--RP 531
            .||||:.....:|:.|:.|:|.|:||||..|..|.|:::|:|.:.|..|.|: |..:  ||
pombe    78 DDCPRKGMVQTSRFALVAHLRSHTGEKPFICSVPECDRSFTRSDALAKHMRTVHEADTLRP 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 12/25 (48%)
C2H2 Zn finger 504..526 CDD:275368 8/22 (36%)
C2H2 Zn finger 534..556 CDD:275368
C2H2 Zn finger 564..586 CDD:275368
iec1NP_594663.1 COG5048 1..>249 CDD:227381 39/126 (31%)
zf-H2C2_2 92..119 CDD:290200 12/26 (46%)
C2H2 Zn finger 108..129 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R588
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.