DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and ref-2

DIOPT Version :9

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001024478.1 Gene:ref-2 / 183539 WormBaseID:WBGene00004335 Length:315 Species:Caenorhabditis elegans


Alignment Length:197 Identity:79/197 - (40%)
Similarity:100/197 - (50%) Gaps:34/197 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 EPENEVIPLICRWTGCDEEFPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLLI 491
            |...:|...:|:.:|         ....||...|  :.....|.|.|..|.|.:|.|.|:|||:.
 Worm    88 ETNGQVCMHVCQNSG---------ELSTHISSNH--ITHDSKFVCLWKGCDREFKMFKAKYKLVN 141

  Fly   492 HMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTH 556
            |||||:||:|..|..  |||.|:|.||||||:|.|:||:|:.|.:.||.|.|:|||||.||...|
 Worm   142 HMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVH 204

  Fly   557 YDTKPYACQLPGCTKRYTDPSSLRKHVKNHALRNANGQLRRKSAGGASVPPSGPKKAAKTRRHSE 621
            ...|||:|..|.|.|.||.|||||||.|.|                     ...||:..:..|.|
 Worm   205 SSHKPYSCMYPDCGKTYTHPSSLRKHTKVH---------------------ENEKKSQLSPEHDE 248

  Fly   622 SA 623
            |:
 Worm   249 SS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 14/25 (56%)
C2H2 Zn finger 504..526 CDD:275368 13/21 (62%)
C2H2 Zn finger 534..556 CDD:275368 12/21 (57%)
C2H2 Zn finger 564..586 CDD:275368 14/21 (67%)
ref-2NP_001024478.1 zf-H2C2_2 139..163 CDD:290200 14/25 (56%)
COG5048 150..>227 CDD:227381 42/78 (54%)
C2H2 Zn finger 154..174 CDD:275368 13/21 (62%)
zf-H2C2_2 166..193 CDD:290200 15/26 (58%)
C2H2 Zn finger 182..204 CDD:275368 12/21 (57%)
C2H2 Zn finger 212..234 CDD:275368 14/21 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D268347at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19818
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.