Sequence 1: | NP_732811.1 | Gene: | lmd / 42717 | FlyBaseID: | FBgn0039039 | Length: | 866 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001024478.1 | Gene: | ref-2 / 183539 | WormBaseID: | WBGene00004335 | Length: | 315 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 79/197 - (40%) |
---|---|---|---|
Similarity: | 100/197 - (50%) | Gaps: | 34/197 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 427 EPENEVIPLICRWTGCDEEFPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLLI 491
Fly 492 HMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTH 556
Fly 557 YDTKPYACQLPGCTKRYTDPSSLRKHVKNHALRNANGQLRRKSAGGASVPPSGPKKAAKTRRHSE 621
Fly 622 SA 623 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lmd | NP_732811.1 | zf-H2C2_2 | 489..515 | CDD:290200 | 14/25 (56%) |
C2H2 Zn finger | 504..526 | CDD:275368 | 13/21 (62%) | ||
C2H2 Zn finger | 534..556 | CDD:275368 | 12/21 (57%) | ||
C2H2 Zn finger | 564..586 | CDD:275368 | 14/21 (67%) | ||
ref-2 | NP_001024478.1 | zf-H2C2_2 | 139..163 | CDD:290200 | 14/25 (56%) |
COG5048 | 150..>227 | CDD:227381 | 42/78 (54%) | ||
C2H2 Zn finger | 154..174 | CDD:275368 | 13/21 (62%) | ||
zf-H2C2_2 | 166..193 | CDD:290200 | 15/26 (58%) | ||
C2H2 Zn finger | 182..204 | CDD:275368 | 12/21 (57%) | ||
C2H2 Zn finger | 212..234 | CDD:275368 | 14/21 (67%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D268347at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19818 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.020 |