DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and ZXDB

DIOPT Version :9

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_009088.1 Gene:ZXDB / 158586 HGNCID:13199 Length:803 Species:Homo sapiens


Alignment Length:387 Identity:96/387 - (24%)
Similarity:148/387 - (38%) Gaps:92/387 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 EPENEVIPLICRWTGCDEEFPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLLI 491
            |||.   |..|.::||.:.|....|...| .:.|  .|:.|.|||.:..|.::|   :...:|.|
Human   388 EPER---PYQCAFSGCKKTFITVSALFSH-NRAH--FREQELFSCSFPGCSKQY---DKACRLKI 443

  Fly   492 HMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTH 556
            |:|.|:||:|..|.|.||...|:.:..|..|:|.|..:|.:.|..:||.|:|:.:.....|..||
Human   444 HLRSHTGERPFLCDFDGCGWNFTSMSKLLRHKRKHDDDRRFMCPVEGCGKSFTRAEHLKGHSITH 508

  Fly   557 YDTKPYACQLPGCTKRYTDPSSLRKHVKNHALRNANGQLRRKSAGGASVPPSGPKKAAKTRRHSE 621
            ..|||:.|.:.||..|::..|||..|.|.|        |:......:..|.|...|.. |.:|| 
Human   509 LGTKPFVCPVAGCCARFSARSSLYIHSKKH--------LQDVDTWKSRCPISSCNKLF-TSKHS- 563

  Fly   622 SALVQRGVGAGVGVAVPSAPGDQRQHRSNSCSEALLLQQHQQQQQQQQQQQKQHQ--PENERTTD 684
                                  .:.|         ::::|:..|....|.:..:.  |.:|.|:.
Human   564 ----------------------MKTH---------MVKRHKVGQDLLAQLEAANSLTPSSELTSQ 597

  Fly   685 RSNCGTGVAANNNSMNFNELSNCIVIIEHNQSGGPAGPATLATATATTTATATYGNGNMAPAPET 749
            |.               |:||:..::...:........|.|.||..         |..:......
Human   598 RQ---------------NDLSDAEIVSLFSDVPDSTSAALLDTALV---------NSGILTIDVA 638

  Fly   750 EVLSVCSGGGSSNSNSNNNRYNANINQLSELEQLLTTAKPT---------GTPAASANGISL 802
            .|.|..:|...:|   |||    ::.|..:...|:.|:.|.         ||.|......||
Human   639 SVSSTLAGHLPAN---NNN----SVGQAVDPPSLMATSDPPQSLDTSLFFGTAATGFQQSSL 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 13/25 (52%)
C2H2 Zn finger 504..526 CDD:275368 8/21 (38%)
C2H2 Zn finger 534..556 CDD:275368 6/21 (29%)
C2H2 Zn finger 564..586 CDD:275368 9/21 (43%)
ZXDBNP_009088.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..260
Required for interaction with ZXDC. /evidence=ECO:0000250 271..577 66/238 (28%)
C2H2 Zn finger 273..295 CDD:275368
zf-C2H2_aberr 304..449 CDD:293622 22/69 (32%)
zf-C2H2 304..328 CDD:278523
C2H2 Zn finger 306..328 CDD:275368
C2H2 Zn finger 336..358 CDD:275368
zf-H2C2_2 350..373 CDD:290200
zf-C2H2 364..386 CDD:278523
C2H2 Zn finger 366..386 CDD:275368
C2H2 Zn finger 395..417 CDD:275368 6/22 (27%)
C2H2 Zn finger 429..448 CDD:275368 6/21 (29%)
COG5048 <441..572 CDD:227381 47/171 (27%)
C2H2 Zn finger 456..478 CDD:275368 8/21 (38%)
zf-H2C2_2 471..497 CDD:290200 10/25 (40%)
C2H2 Zn finger 486..508 CDD:275368 6/21 (29%)
C2H2 Zn finger 516..538 CDD:275370 9/21 (43%)
Required for transcriptional activation. /evidence=ECO:0000250 576..703 30/149 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.