DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and glis2b

DIOPT Version :9

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001276814.1 Gene:glis2b / 102725539 ZFINID:ZDB-GENE-091204-120 Length:489 Species:Danio rerio


Alignment Length:225 Identity:104/225 - (46%)
Similarity:131/225 - (58%) Gaps:16/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 KPDSTCCDPEAEPENEVIPLICRWTGCDEEFPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRY 480
            :|..|...|:...:.:   |.|||..|...|...|..|:|:...||...|...:.|.|..|.|:.
Zfish   146 QPKDTRASPDLSADEQ---LACRWRKCHLLFDSLQDLVDHVNDFHVKPEKDSGYCCHWEGCARKG 207

  Fly   481 KPFNARYKLLIHMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSN 545
            :.||||||:|||:|.|:.|||::|  |.|||:||||||||||.||||||:||.|.|:||.|.:||
Zfish   208 RGFNARYKMLIHIRTHTNEKPHRC--PTCNKSFSRLENLKIHNRSHTGEKPYICPYEGCNKRYSN 270

  Fly   546 SSDRAKHQRTHYDTKPYACQLPGCTKRYTDPSSLRKHVKNHALRNANGQLRRKSAGGASVPPSGP 610
            ||||.||.||||..|||.|::.||.||||||||||||:|.|      |....:..||........
Zfish   271 SSDRFKHTRTHYVDKPYYCKMVGCLKRYTDPSSLRKHIKAH------GHFVAQEQGGGVGSLIKQ 329

  Fly   611 KKAAKTRRHSESALVQRGVGAGVGVAVPSA 640
            .:.|...:.||...|     :|..:.:|||
Zfish   330 SQIAGVGKDSELTYV-----SGAHIIIPSA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 14/25 (56%)
C2H2 Zn finger 504..526 CDD:275368 16/21 (76%)
C2H2 Zn finger 534..556 CDD:275368 14/21 (67%)
C2H2 Zn finger 564..586 CDD:275368 16/21 (76%)
glis2bNP_001276814.1 C2H2 Zn finger 207..223 CDD:275368 10/15 (67%)
zf-H2C2_2 219..240 CDD:290200 12/22 (55%)
COG5048 227..>304 CDD:227381 55/78 (71%)
C2H2 Zn finger 231..251 CDD:275368 16/21 (76%)
zf-H2C2_2 243..270 CDD:290200 18/26 (69%)
C2H2 Zn finger 259..281 CDD:275368 14/21 (67%)
C2H2 Zn finger 289..311 CDD:275368 16/21 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.