DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmd and glis2a

DIOPT Version :9

Sequence 1:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_009294691.1 Gene:glis2a / 102725534 ZFINID:ZDB-GENE-130102-1 Length:446 Species:Danio rerio


Alignment Length:187 Identity:97/187 - (51%)
Similarity:121/187 - (64%) Gaps:10/187 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 PEAEPENEVIPLICRWTGCDEEFPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYK 488
            ||...:.:   |.|||..|...|...|..|:|:...||...|...:.|.|..|.|:.:.||||||
Zfish   135 PEPSGDEQ---LACRWLKCHLLFESLQDLVDHVNDSHVKPEKASGYCCHWEGCARKGRGFNARYK 196

  Fly   489 LLIHMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQ 553
            :|||:|.|:.|||:.|  |.|:|:||||||||||.||||||:||.|.|:||.|.:||||||.||.
Zfish   197 MLIHIRTHTNEKPHHC--PTCHKSFSRLENLKIHTRSHTGEKPYICPYEGCNKRYSNSSDRFKHT 259

  Fly   554 RTHYDTKPYACQLPGCTKRYTDPSSLRKHVK--NHAL---RNANGQLRRKSAGGASV 605
            ||||..|||.|::.||.||||||||||||:|  .||:   |.|:.:..|..:..||:
Zfish   260 RTHYVDKPYCCKMVGCLKRYTDPSSLRKHIKAHGHAVVQDRAASPRTNRLESDTASL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 13/25 (52%)
C2H2 Zn finger 504..526 CDD:275368 15/21 (71%)
C2H2 Zn finger 534..556 CDD:275368 14/21 (67%)
C2H2 Zn finger 564..586 CDD:275368 16/23 (70%)
glis2aXP_009294691.1 C2H2 Zn finger 188..204 CDD:275368 10/15 (67%)
zf-H2C2_2 200..221 CDD:290200 11/22 (50%)
COG5048 208..>285 CDD:227381 54/78 (69%)
C2H2 Zn finger 212..232 CDD:275368 15/21 (71%)
zf-H2C2_2 224..251 CDD:290200 18/26 (69%)
C2H2 Zn finger 240..262 CDD:275368 14/21 (67%)
C2H2 Zn finger 270..292 CDD:275368 16/21 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.