DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and CYTIP

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_004279.3 Gene:CYTIP / 9595 HGNCID:9506 Length:359 Species:Homo sapiens


Alignment Length:150 Identity:30/150 - (20%)
Similarity:60/150 - (40%) Gaps:34/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ENYGFQLTRSKWDP----------YPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIA 91
            |.:||::  ..:.|          :..:|::...:||...||:.||.:..:||....|....::.
Human    86 ETFGFEI--QSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGFTYKQVV 148

  Fly    92 KMVKSQKDCVTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAM 156
            .:::|..:.:||...|.                ...|:|..  ||:.|::::..:....:...::
Human   149 DLIRSSGNLLTIETLNG----------------TMILKRTE--LEAKLQVLKQTLKQKWVEYRSL 195

  Fly   157 QCQNGHLLCVDCRIRSERCP 176
            |.|...||..|    :..||
Human   196 QLQEHRLLHGD----AANCP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 16/76 (21%)
CYTIPNP_004279.3 PDZ_signaling 76..161 CDD:238492 16/76 (21%)
Interaction with CYTH1 166..188 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.