DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and NHERF2

DIOPT Version :10

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_054170405.1 Gene:NHERF2 / 9351 HGNCID:11076 Length:360 Species:Homo sapiens


Alignment Length:106 Identity:37/106 - (34%)
Similarity:57/106 - (53%) Gaps:4/106 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 STSNEDGQHGDGSSVRLLRIPRAA---PAMENYGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPG 71
            |.|:|.|:......:|.|| ||..   ...:.|||.|...|..|..::..|..|:|||..||:..
Human   130 SHSSEAGKKDVSGPLRELR-PRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQ 193

  Fly    72 DCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTILCWNSECDK 112
            |.::||||.:|.|||.:|:...:|:::|...:|..:.|.|:
Human   194 DRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948 30/81 (37%)
RING-HC_SIAHs 143..179 CDD:438233
NHERF2XP_054170405.1 PDZ_NHERF-like 10..89 CDD:467249
PDZ_NHERF-like 150..229 CDD:467249 27/78 (35%)
EBP50_C 232..360 CDD:462654 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.