DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and SLC9A3R2

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_016879383.1 Gene:SLC9A3R2 / 9351 HGNCID:11076 Length:372 Species:Homo sapiens


Alignment Length:82 Identity:30/82 - (36%)
Similarity:47/82 - (57%) Gaps:2/82 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RAAPAMENYGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVK 95
            |..|  :.|||.|...|..|..::..|..|:|||..||:..|.::||||.:|.|||.:|:...:|
Human   201 RKGP--QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIK 263

  Fly    96 SQKDCVTILCWNSECDK 112
            :::|...:|..:.|.|:
Human   264 AREDEARLLVVDPETDE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 27/72 (38%)
SLC9A3R2XP_016879383.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6410
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14191
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.