DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and AT1G66610

DIOPT Version :10

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_176834.1 Gene:AT1G66610 / 842979 AraportID:AT1G66610 Length:366 Species:Arabidopsis thaliana


Alignment Length:108 Identity:25/108 - (23%)
Similarity:43/108 - (39%) Gaps:27/108 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LRLVECPVCGVTISPPAMQCQNGHLLCVDCRIR-SERCPVCRDFYTPRRALLAEQIFLTIANAFE 202
            |.|::||:|...::.|..||..||:.|..|... |.:||.|.               |.|.|   
plant    51 LDLLDCPICCNALTIPIFQCDKGHIACSSCCTNVSNKCPYCS---------------LAIGN--- 97

  Fly   203 MCRSENKLRQKLFAGITRPVVGRQDRITGQ-DTWRKRRPVLPT 244
                   .|.::...:....:.|...:.|: .:.|::|..:|:
plant    98 -------YRSRIMERVVEAFIVRCPIVAGEASSSRQKRLRVPS 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948
RING-HC_SIAHs 143..179 CDD:438233 13/36 (36%)
AT1G66610NP_176834.1 RING-HC_SIAHs 54..92 CDD:438233 13/37 (35%)
Sina 185..>313 CDD:460824
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.