DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and SINAT2

DIOPT Version :10

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_191363.1 Gene:SINAT2 / 824973 AraportID:AT3G58040 Length:308 Species:Arabidopsis thaliana


Alignment Length:143 Identity:41/143 - (28%)
Similarity:63/143 - (44%) Gaps:35/143 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 ILRLVECPVCGVTISPPAMQCQNGHLLCVDCRIRSER-CPVCRDFYTPRRALLAEQIFLTIANAF 201
            :..|:|||||...:.||..||.|||.||.:|::|.:. ||.||......|.|..|:    :|.:.
plant    54 VYELLECPVCTNLMYPPIHQCPNGHTLCSNCKLRVQNTCPTCRYELGNIRCLALEK----VAESL 114

  Fly   202 EM-CRSEN-----------KLRQK---LFAGITRPVVGRQDRITGQDTWRKRRPVLPT------N 245
            |: ||.:|           ||:.:   .|...|.|..|.:..:||.         :||      :
plant   115 EVPCRYQNLGCHDIFPYYSKLKHEQHCRFRPYTCPYAGSECSVTGD---------IPTLVVHLKD 170

  Fly   246 KFLTKLLEGCAYS 258
            .....:.:||.::
plant   171 DHKVDMHDGCTFN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948
RING-HC_SIAHs 143..179 CDD:438233 18/36 (50%)
SINAT2NP_191363.1 RING-HC_SIAHs 58..96 CDD:438233 18/37 (49%)
Sina 102..301 CDD:460824 20/95 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.