powered by:
Protein Alignment CG6688 and AT3G13672
DIOPT Version :9
| Sequence 1: | NP_651110.1 |
Gene: | CG6688 / 42716 |
FlyBaseID: | FBgn0039038 |
Length: | 424 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001319542.1 |
Gene: | AT3G13672 / 820573 |
AraportID: | AT3G13672 |
Length: | 243 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 63 |
Identity: | 18/63 - (28%) |
| Similarity: | 27/63 - (42%) |
Gaps: | 9/63 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 133 LVLES-ILRLVECPVCGVTISPPAMQCQNGHL-----LCVDCRIRSERCPVCRDFYTPRRALL 189
|.:|| :..|::.||....||....:|.|.|: ...:|.....:|.|..|. :|.||
plant 8 LQVESRVHELLDFPVHTNQISSAIYECPNDHIENPKKKPYNCPHSGAKCDVTGDI---QRLLL 67
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG6688 | NP_651110.1 |
PDZ_signaling |
24..104 |
CDD:238492 |
|
| AT3G13672 | NP_001319542.1 |
None |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3002 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D780610at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.
