DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and siah1

DIOPT Version :10

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_005159200.1 Gene:siah1 / 80955 ZFINID:ZDB-GENE-010319-31 Length:334 Species:Danio rerio


Alignment Length:135 Identity:41/135 - (30%)
Similarity:58/135 - (42%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AALCGLKPGDC-VLEVNGNDVLGLRVSEIAKMVKSQKDCVTILCWNSECDKDCDTNSICCAP--- 123
            ||....||.:. ..:....||||..:.|     :..:...|.|          .|.:..|.|   
Zfish    24 AARTASKPKEVHTFQGKKKDVLGNLMDE-----EMSRQTATAL----------PTGTSKCPPSQR 73

  Fly   124 MPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRAL 188
            :|| |...:.....:..|.|||||...:.||.:|||:|||:|.:||.:...||.||......|.|
Zfish    74 VPT-LSGTTASNSDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNL 137

  Fly   189 LAEQI 193
            ..|::
Zfish   138 AMEKV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948 10/41 (24%)
RING-HC_SIAHs 143..179 CDD:438233 18/35 (51%)
siah1XP_005159200.1 RING-HC_SIAH2 88..138 CDD:438410 22/49 (45%)
Sina 134..330 CDD:460824 3/9 (33%)

Return to query results.
Submit another query.