DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and siah1

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_005159200.1 Gene:siah1 / 80955 ZFINID:ZDB-GENE-010319-31 Length:334 Species:Danio rerio


Alignment Length:135 Identity:41/135 - (30%)
Similarity:58/135 - (42%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AALCGLKPGDC-VLEVNGNDVLGLRVSEIAKMVKSQKDCVTILCWNSECDKDCDTNSICCAP--- 123
            ||....||.:. ..:....||||..:.|     :..:...|.|          .|.:..|.|   
Zfish    24 AARTASKPKEVHTFQGKKKDVLGNLMDE-----EMSRQTATAL----------PTGTSKCPPSQR 73

  Fly   124 MPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRAL 188
            :|| |...:.....:..|.|||||...:.||.:|||:|||:|.:||.:...||.||......|.|
Zfish    74 VPT-LSGTTASNSDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNL 137

  Fly   189 LAEQI 193
            ..|::
Zfish   138 AMEKV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 10/41 (24%)
siah1XP_005159200.1 Sina 134..330 CDD:281181 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.