DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and PDZD7

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001182192.1 Gene:PDZD7 / 79955 HGNCID:26257 Length:1033 Species:Homo sapiens


Alignment Length:458 Identity:98/458 - (21%)
Similarity:147/458 - (32%) Gaps:171/458 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSNEDGQHGDGSSVRLLRIPRAAPAMENY--GFQLTRSK-WDPYPWVCEVAAGTPAALCGLKPGD 72
            ||:|||       ||  ||.......:::  ||.:...| :....:|.:|..|..|...|:|.||
Human   201 TSSEDG-------VR--RIVHLYTTSDDFCLGFNIRGGKEFGLGIYVSKVDHGGLAEENGIKVGD 256

  Fly    73 CVLEVNGNDVLGLRVSEIAKMVKSQ----------------KDCVTILCWNSECDKDCDTNSICC 121
            .||..||.....:..|:..:::|.|                |:.|:..||     .|..:|.:  
Human   257 QVLAANGVRFDDISHSQAVEVLKGQTHIMLTIKETGRYPAYKEMVSEYCW-----LDRLSNGV-- 314

  Fly   122 APMPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRR 186
                  |::||...||...:..|     ..|.|   ..:|.|       .|:|..:|.....|  
Human   315 ------LQQLSPASESSSSVSSC-----ASSAP---YSSGSL-------PSDRMDICLGQEEP-- 356

  Fly   187 ALLAEQIFLTIANAFEMCRSENKLRQKLFAGITRPVVGRQD-----------RITGQDTWRKRRP 240
                                          |...|..||.|           |:   :||...||
Human   357 ------------------------------GSRGPGWGRADTAMQTEPDAGGRV---ETWCSVRP 388

  Fly   241 VLPTNKFLTKLLEGCAYSTDN----------LSPSNAATLL----RTNTTDVAGDS-----SEIP 286
                    |.:|...|..:|.          ||.|....||    |.........|     .|..
Human   389 --------TVILRDTAIRSDGPHPGRRLDSALSESPKTALLLALSRPRPPITRSQSYLTLWEEKQ 445

  Fly   287 ARTSPVTATPPE-------RTTMHA-------------------TLDANAAHPSLSTNDLQQE-G 324
            .|....:.:|.|       :|.|:.                   |||:.:...:....|:::. |
Human   446 QRKKEKSGSPGEKGALQRSKTLMNLFFKGGRQGRLARDGRREAWTLDSGSLAKTYPRLDIEKAGG 510

  Fly   325 VKPNAEGV------DEESGTNSSHISATSLHGPPLPASVSPGINESSGLQPVRIPPVTPSQDLPQ 383
            |.|..:.|      |:|.|  .:.:||.|    ..|:|..|.::|.......|.|.:   |||.|
Human   511 VGPVQKFVTWRLRRDQERG--RALLSARS----GSPSSQLPNVDEQVQAWESRRPLI---QDLAQ 566

  Fly   384 QVV 386
            :::
Human   567 RLL 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 24/98 (24%)
PDZD7NP_001182192.1 PDZ_signaling 84..164 CDD:238492
PDZ_signaling 209..289 CDD:238492 20/79 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..380 16/103 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..464 3/19 (16%)
HN_PDZD7_like 554..630 CDD:259824 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 754..864
PDZ_signaling 860..948 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 943..1033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.