DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and cyhr1

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001070208.1 Gene:cyhr1 / 767773 ZFINID:ZDB-GENE-060929-720 Length:375 Species:Danio rerio


Alignment Length:113 Identity:34/113 - (30%)
Similarity:47/113 - (41%) Gaps:24/113 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LESILRLVECPVCGVTISPP---AMQCQNGHLLCVDC--------RIRSER--CPVCRDFYTPR- 185
            ||..|..|.|  |.|.:..|   ..||.||||:|..|        |::.|:  ||.||...:.. 
Zfish    72 LEERLYSVLC--CTVCLDLPKASVYQCTNGHLMCAGCFIHLLADSRLKEEQATCPNCRCEISKSL 134

  Fly   186 --RALLAEQIFLTIANAFEMCRSENKLRQKLFAGITRPVVGR-QDRIT 230
              |.|..|:....:.:....|     |:|...:|:.|..... |||:|
Zfish   135 CCRNLAVEKAVSELPSECSYC-----LKQFPRSGLDRHQTEECQDRVT 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
cyhr1NP_001070208.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..65
Sina 137..>198 CDD:302762 12/46 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.