DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and Nherf2

DIOPT Version :10

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_075542.2 Gene:Nherf2 / 65962 MGIID:1890662 Length:337 Species:Mus musculus


Alignment Length:161 Identity:47/161 - (29%)
Similarity:73/161 - (45%) Gaps:24/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 STSNEDGQHGDGSSVRLLRIPRAA---PAMENYGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPG 71
            |..::.||.......|.|| ||..   ...:.|||.|...|..|..::..|..|:||:..||:..
Mouse   130 SLGSDTGQKDVNGPPRELR-PRLCHLRRGPQGYGFNLHSDKSRPGQYIRSVDPGSPASHSGLRAQ 193

  Fly    72 DCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTILCWNSECDKDCDTNSICCAPMPTSLRRLSLV-- 134
            |.::||||.:|.|||.:|:...:|:|:|...:|..:.|.|:              ..:||.::  
Mouse   194 DRLIEVNGQNVEGLRHAEVVARIKAQEDEARLLVVDPETDE--------------HFKRLRVIPT 244

  Fly   135 LESILRLVECPVCGVTISPPAMQCQNGHLLC 165
            .|.:...:..||...| ||..:   ||..:|
Mouse   245 EEHVEGPLPSPVTNGT-SPAQL---NGGSVC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948 30/81 (37%)
RING-HC_SIAHs 143..179 CDD:438233 8/23 (35%)
Nherf2NP_075542.2 PDZ_NHERF-like 10..89 CDD:467249
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..145 3/14 (21%)
PDZ_NHERF-like 150..229 CDD:467249 27/78 (35%)
EBP50_C 232..337 CDD:462654 12/58 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..337 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.