DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and Slc9a3r1

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_067605.1 Gene:Slc9a3r1 / 59114 RGDID:708538 Length:356 Species:Rattus norvegicus


Alignment Length:148 Identity:36/148 - (24%)
Similarity:59/148 - (39%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTI 103
            |||.|...|.....::..|..|:||...||..||.::||||.:|......::...:::..:.|.:
  Rat    24 YGFHLHGEKGKVGQFIRLVEPGSPAEKSGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRL 88

  Fly   104 LCWNSECDKDCDTNSICCAPMPTSLRRLSL-VLESILRLVECPVCGVTISPPAM----------Q 157
            |..:.|.|:              .|::|.: :.|.:||..|   ......|||.          :
  Rat    89 LVVDPETDE--------------QLKKLGVPIREELLRAQE---KSEHTEPPAAADTKKAGDQNE 136

  Fly   158 CQNGHLLCVDCRIRSERC 175
            .:..||  ..|.:|...|
  Rat   137 AEKSHL--ERCELRPRLC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 19/64 (30%)
Slc9a3r1NP_067605.1 PDZ_signaling 12..91 CDD:238492 20/66 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142 4/31 (13%)
PDZ_signaling 149..228 CDD:238492 1/4 (25%)
EBP50_C 232..356 CDD:286142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14191
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.