Protein Alignment CG6688 and Tamalin

DIOPT Version :9

• Sequence 1: NP_651110.1
• Gene: CG6688 / 42716
• FlyBaseID: FBgn0039038
• Length: 424
• Species: Drosophila melanogaster
• Sequence 2: NP_062391.3
• Gene: Tamalin / 56149
• MGIID: 1860303
• Length: 392
• Species: Mus musculus
• Alignment Length: 68
• Identity: 22/68 - (32%)
• Similarity: 36/68 - (52%)
• Gaps: 8/68 - (11%)

  Fly    37 ENYGFQL--------TRSKWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKM 93
            :.:||::        ...:.:...:||.|...:||.|.||.|||.:..|||.:|.|:|..||..:
Mouse   109 QTFGFEIQTYGLHHREEQRVEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDI 173

  Fly    94 VKS 96
            :|:
Mouse   174 IKA 176

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG6688	NP_651110.1	PDZ_signaling	24..104	CDD:238492	22/68 (32%)
Tamalin	NP_062391.3	Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	1..50
		PDZ_signaling	99..184	CDD:238492	22/68 (32%)
		Interaction with PSCD3. /evidence=ECO:0000269|PubMed:10828067	180..257
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	294..315

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900