DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and nherf4a

DIOPT Version :10

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_073779792.1 Gene:nherf4a / 557269 ZFINID:ZDB-GENE-080430-1 Length:506 Species:Danio rerio


Alignment Length:86 Identity:20/86 - (23%)
Similarity:37/86 - (43%) Gaps:21/86 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PRAAPAMEN---------------------YGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPGDC 73
            |.|.||:|:                     :||.|...:..|..::.:|.:|:.....||:..|.
Zfish   377 PFATPALEHPEGHQNPPQPRLCELHKEGTGFGFNLGCVENKPGTYIGQVVSGSTGERAGLRKWDV 441

  Fly    74 VLEVNGNDVLGLRVSEIAKMV 94
            ::||||.:|......|:.:::
Zfish   442 LIEVNGQNVEDEYFDEVVRLI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948 20/86 (23%)
RING-HC_SIAHs 143..179 CDD:438233
nherf4aXP_073779792.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.