DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and lnx2a

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001106696.2 Gene:lnx2a / 553331 ZFINID:ZDB-GENE-060228-2 Length:737 Species:Danio rerio


Alignment Length:53 Identity:19/53 - (35%)
Similarity:29/53 - (54%) Gaps:3/53 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VAAGTPAALCG-LKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKD--CVTILCW 106
            :..||||...| ||.||.::.|||....|:..|.:..|:|.|:.  .:|::.|
Zfish   680 IVLGTPAYYDGRLKCGDMIVAVNGLSTAGMSHSALVPMLKEQRSRVALTVVSW 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 18/49 (37%)
lnx2aNP_001106696.2 zf-RING_2 49..87 CDD:290367
PDZ 267..353 CDD:214570
PDZ_signaling 375..455 CDD:238492
PDZ_signaling 515..600 CDD:238492
PDZ_signaling 646..730 CDD:238492 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.