DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and siah1

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_012816483.1 Gene:siah1 / 548553 XenbaseID:XB-GENE-1014415 Length:313 Species:Xenopus tropicalis


Alignment Length:53 Identity:24/53 - (45%)
Similarity:32/53 - (60%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRALLAEQI 193
            |.|||||...:.||.:|||:|||:|.:||.:...||.||......|.|..|::
 Frog    69 LFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
siah1XP_012816483.1 RING-HC_SIAH1 70..109 CDD:319665 20/38 (53%)
RING-HC finger (C3HC4-type) 72..106 CDD:319665 17/33 (52%)
Sina 113..309 CDD:367355 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.