DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and PDZK1

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_024303384.1 Gene:PDZK1 / 5174 HGNCID:8821 Length:539 Species:Homo sapiens


Alignment Length:85 Identity:28/85 - (32%)
Similarity:42/85 - (49%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIPRAAPAMENYGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAK 92
            ::.|.|.....|||.|...:..|..::.||..|.||.|.||:..|.::||||.:||.....::..
Human   397 KLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVD 461

  Fly    93 MVKSQKDCVTILCWNSECDK 112
            .::|....||:|.    |.|
Human   462 RIQSSGKNVTLLV----CGK 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 25/75 (33%)
PDZK1XP_024303384.1 PDZ_signaling 27..107 CDD:238492
PDZ 152..232 CDD:214570
PDZ_signaling 261..340 CDD:238492
PDZ 395..475 CDD:214570 26/81 (32%)
F1-ATPase_gamma <457..>501 CDD:320933 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14191
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.