DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and CYHR1

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001317547.1 Gene:CYHR1 / 50626 HGNCID:17806 Length:404 Species:Homo sapiens


Alignment Length:313 Identity:63/313 - (20%)
Similarity:106/313 - (33%) Gaps:106/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LESILRLVECPVCGVTISPP---AMQCQNGHLLCVDC--------RIRSER--CPVCRDFYTPR- 185
            ||..|..|.|  |.|.:..|   ..||.||||:|..|        |::.|:  ||.||...:.. 
Human   101 LEERLYSVLC--CTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSL 163

  Fly   186 --RALLAEQIFLTIANAFEMCRSENKLRQKLFAGITRPVVGR------QDRITGQDTWRKRRPVL 242
              |.|..|:....:.:....|     |||     ..|.::.|      |||:| |..:::     
Human   164 CCRNLAVEKAVSELPSECGFC-----LRQ-----FPRSLLERHQKEECQDRVT-QCKYKR----- 212

  Fly   243 PTNKFLTKLLEGCAYSTDNLSPSNAATLLRTNTTDVAGDSSEIPARTSPVTATPPERTTMHATLD 307
                      .||.:.                                    .|....|:|   :
Human   213 ----------IGCPWH------------------------------------GPFHELTVH---E 228

  Fly   308 ANAAHPSLSTNDLQQEGVKPNAEGVDEESGTNSSHISATSLHGPPLPASVSPGIN-ESSGLQPVR 371
            |..|||:.:.::|.:     ..:|:|:      ||.....|:.     |:...:: |..|...|:
Human   229 AACAHPTKTGSELME-----ILDGMDQ------SHRKEMQLYN-----SIFSLLSFEKIGYTEVQ 277

  Fly   372 IPPVTPSQDLPQQVVQTKPASLLYRCPCKLQDPQDPAKDLHQNCCYKSAFRLL 424
            ..|......:.:...:|...::|.:.........|..::.:.:|....:|:||
Human   278 FRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCKRTLSFQLL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
CYHR1NP_001317547.1 RING-HC_CYHR1 108..156 CDD:319419 17/49 (35%)
RING-HC finger (C3HC4-type) 111..155 CDD:319419 15/43 (35%)
Sina 166..>227 CDD:388509 18/122 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.