DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and CG34375

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:397 Identity:106/397 - (26%)
Similarity:169/397 - (42%) Gaps:83/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GFQLTRSKWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMV----KSQKDC 100
            |..|:|:.|||||||..|.|.:.|...|::.||.:||:||.|||||::||:|..:    :|..:.
  Fly    16 GLNLSRAPWDPYPWVSGVQAKSSAERGGVRLGDTLLELNGADVLGLKISELANRLQDHWQSGAEV 80

  Fly   101 VTILCWNSECDKDCD------TNSICCAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQ 159
            ||::.|..:.:.|.:      ::::.......||::.:..|:.|.:|:|||||...|.||..||.
  Fly    81 VTLMMWRQQANIDPNEDPAEASHAVQHGINQQSLQKFATCLQHISQLLECPVCLEVIKPPGWQCC 145

  Fly   160 NGHLLCVDCRIRSERCPVCRDFYTPR-RALLAEQIFLTIANAFEMCRSENKLRQKLFAGITRPVV 223
            |||:||.:||.||.:|||||....|| |.||::::|..:|.:|. |..                 
  Fly   146 NGHVLCNNCRSRSVKCPVCRVPLGPRGRCLLSDKLFTLLAESFP-CDG----------------- 192

  Fly   224 GRQDRITGQDTWRKRRPVLP-TNKF-------LTKLLEGCAYSTDNLSPSNAATLLRTNTTDVAG 280
            |:.:::.......|...|.. ||::       |.|...|.:.....:|......|:..:..::..
  Fly   193 GKTNKVAASQGHGKLSSVNKCTNEYHNQPKMALAKTSSGKSKCGKQISRQLETVLVDQSPREIRR 257

  Fly   281 DSSEIPARTSPVTATPPERTTMHATLDANAAHPSLSTNDLQQEG-----VKPNAE---------G 331
            .|.:...:...|......|.|:     ....|...:.....:||     |||..:         |
  Fly   258 KSQQGQEQEQAVQEAVLPRCTL-----IKVQHQEAAVEHFSEEGHNNMLVKPKLKLSKKSWRITG 317

  Fly   332 VDEESGTNSSHISATSLHGPPLPASVSPGINESSGLQPVRIPPVTPSQDLPQQVVQTKPAS---- 392
            .|:: |.....:           |:::.|:......|          |...||:...|.||    
  Fly   318 PDQD-GLRCDEV-----------ATINNGVQVQEQQQ----------QQERQQLGHEKSASSESE 360

  Fly   393 -LLYRCP 398
             ..|.||
  Fly   361 YQNYHCP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 31/67 (46%)
CG34375NP_001163693.1 PDZ 13..86 CDD:238080 31/69 (45%)
RING 129..168 CDD:238093 24/38 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.