DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and loco

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster


Alignment Length:345 Identity:61/345 - (17%)
Similarity:110/345 - (31%) Gaps:134/345 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 DFYTPRRALLAEQIFLTIANAFEMCRSENKL------RQKLFAGITRPVVGR------QDRITGQ 232
            |...|.:.|..:::.:....||::...:.|:      .:|....:.||::.:      |.::..:
  Fly  1124 DVQQPSQILAGKEVVIERRVAFKLDLPDPKVISVKSKPKKQLHEVIRPILSKYNYKMEQVQVIMR 1188

  Fly   233 DTW------------------------------------RKRRPVLP---------TNKFLTKLL 252
            ||.                                    ::.:|:.|         |||...:||
  Fly  1189 DTQVPIDLNQPVTMADGQRLRIVMVNSDFQVGGGSSMPPKQSKPMKPLPQGHLDELTNKVFNELL 1253

  Fly   253 EG---------------CAYSTDNLSPSNAATL---------------------LRTNTTDVAGD 281
            ..               |:..: |.:||..::|                     |:..:|..:..
  Fly  1254 ASKADAAASEKSRPVDLCSMKS-NEAPSETSSLFERMRRQQRDGGNIPASKLPKLKKKSTSSSQQ 1317

  Fly   282 SSEIPARTSPVTATP--PERTTMHATLDANAAHPSLSTNDLQQEGVK-PNAEGVDEESGT----- 338
            |.|  |.|:...|.|  |....:.|.:............|...||:| .....::::.||     
  Fly  1318 SEE--AATTQAVADPKKPIIAKLKAGVKLQVTERVAEHQDELLEGLKRAQLARLEDQRGTEINFD 1380

  Fly   339 ------NSSHISATSLHGPPLPASVSPGINESSGLQPVRIPPVTPSQDLPQQVVQ------TKPA 391
                  |..::|          |:||......:.|.||...|.||: ::||...:      .:|.
  Fly  1381 LPDFLKNKENLS----------AAVSKLRKVRASLSPVSKVPATPT-EIPQPAPRLSITRSQQPV 1434

  Fly   392 SLLYRCPCKLQDPQDPAKDL 411
            |     |.|:.  |:|..||
  Fly  1435 S-----PMKVD--QEPETDL 1447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412 3/20 (15%)
RBD 1144..1213 CDD:128731 9/68 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.