DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and Syn1

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster


Alignment Length:173 Identity:36/173 - (20%)
Similarity:62/173 - (35%) Gaps:40/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 STSNEDGQH----------GDGSSVRLLRIPRAAPAMENY-----------GFQLTRSKWDPYP- 52
            |.||::|..          |||..:.:..:|......:.:           |..:...:.:..| 
  Fly   125 SASNDNGDRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGISIKGGRENRMPI 189

  Fly    53 WVCEVAAGTPAALC-GLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTILCWNSECDKDCDT 116
            .:.::..|..|... ||..||.:|.|||.::......|..:.:|.....|           |.:.
  Fly   190 LISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRVV-----------DLEV 243

  Fly   117 NSICCAPMPTSLRRLSLVLE---SILRLVECPV-CGVTISPPA 155
            ..:  ..:....|:.|::.|   .:.|...||: .||..||||
  Fly   244 KFL--REVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 16/92 (17%)
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 16/91 (18%)
PHsplit_syntrophin <293..351 CDD:269960
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.