DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and sinah

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648927.1 Gene:sinah / 39885 FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster


Alignment Length:97 Identity:34/97 - (35%)
Similarity:49/97 - (50%) Gaps:13/97 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 QKDCVTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNG 161
            :||.|.:           .:..:...|:.|:  |.....:.::.|:|||||...|.||.|||..|
  Fly    72 RKDSVAV-----------QSGIVATGPLDTT--RSGARDDFLMALLECPVCFGYIMPPIMQCPRG 123

  Fly   162 HLLCVDCRIRSERCPVCRDFYTPRRALLAEQI 193
            ||:|..||.:...|||||.|.|..|:|..|::
  Fly   124 HLICSTCRSKLTICPVCRVFMTNIRSLAMEKV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 3/6 (50%)
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 18/33 (55%)
Sina 147..341 CDD:281181 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.