DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and bbg

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster


Alignment Length:232 Identity:63/232 - (27%)
Similarity:87/232 - (37%) Gaps:64/232 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 TPRRALLAEQIFLT-IANA-FEMCRSENKLRQKLFAGITR--------PVVGRQDRITGQDTWRK 237
            ||...|....|..| |..| |...::|.:::..|.|...:        |:|...   |.|.|..|
  Fly   405 TPTNELKESPISATKIPKAKFSRAKTEGEIKLHLPAPKQQSPQSKSRIPIVSTP---TAQKTVPK 466

  Fly   238 RRPVLPTNKFLTKLLEGCAYSTDNLSPSNAATLL--RTNTTDV--------AGDSSEIPARTSPV 292
              ||.||       :.|...|      ||...||  :.:.||:        :.:||..|......
  Fly   467 --PVSPT-------MNGTPLS------SNIPRLLQKQKSETDLKLNLYRSKSKESSPRPPLQRAN 516

  Fly   293 TATPPERTTMHATLDANAAHPSLSTNDLQQEGVKPNAEGVDEESGTNSSHISATSLHGP-PLPAS 356
            :|..||||.:...|:.|    |.|:|.|:..          ...|::||..|..|..|| |.|. 
  Fly   517 SAEAPERTFIPVLLNGN----SKSSNSLESV----------SSIGSSSSGNSVRSPKGPKPKPP- 566

  Fly   357 VSPGINESSGLQPVRIP-----PVTPSQDLPQQVVQT 388
                 .....||..:||     |.||.|.:|:..:||
  Fly   567 -----ERVQSLQKTQIPKLQALPTTPPQQIPKLSMQT 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492
PDZ_signaling 2553..2634 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.