DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6688 and dysc

DIOPT Version :9

Sequence 1:	NP_651110.1	Gene:	CG6688 / 42716	FlyBaseID:	FBgn0039038	Length:	424	Species:	Drosophila melanogaster
Sequence 2:	NP_001261810.1	Gene:	dysc / 39533	FlyBaseID:	FBgn0264006	Length:	1254	Species:	Drosophila melanogaster

Alignment Length:	52	Identity:	17/52 - (32%)
Similarity:	25/52 - (48%)	Gaps:	6/52 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    53 WVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTIL 104
            ::..:...:.|...||:|||.:|||||.....:...|      :.|.||.||
  Fly   324 YISRIEENSVAERAGLRPGDTILEVNGTPFTSINHEE------ALKRCVQIL 369

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6688	NP_651110.1	PDZ_signaling	24..104	CDD:238492	15/50 (30%)
dysc	NP_001261810.1	PDZ_signaling	294..380	CDD:238492	17/52 (33%)
		PDZ_signaling	466..543	CDD:238492
		HN_L-whirlin_R2_like	573..653	CDD:259823
		PDZ_signaling	886..971	CDD:238492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900