DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and Zasp66

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:194 Identity:44/194 - (22%)
Similarity:72/194 - (37%) Gaps:39/194 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 RQKLFAGITRPVVGRQDRITGQDTWRKRRPVLPTNKFLTKLLEGCAYSTDNLSPSNAATLLRTNT 275
            |::..:|:.:.|....::..|..........|.....::|:.|   |...:||.::|..|.|   
  Fly    47 RRRSSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDIISKIGE---YDARDLSHADAQQLFR--- 105

  Fly   276 TDVAGDSSEIP---------ARTSPVT--ATPPERTTMHATLDANAAHPSLSTNDLQQEGVKPNA 329
                |..:||.         |.|...|  |.|..|        :|:..|.::.:.:...|..|..
  Fly   106 ----GAGNEIRLVVHRDNKIAYTQGATQEAGPGSR--------SNSTLPPVTPDLMPHRGPSPFL 158

  Fly   330 EGVDEESGTNSSHIS-ATSLHGPPLPASVSPGINESSGLQ-PVRIPPVTPSQDLPQQVVQTKPA 391
            .|        .||.. |..|....||.:|.|.:|.|.|.: |..:....|::|..|.|.:.:.|
  Fly   159 PG--------PSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 12/56 (21%)
DUF4749 285..359 CDD:292558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.