DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and CG32486

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster


Alignment Length:230 Identity:53/230 - (23%)
Similarity:77/230 - (33%) Gaps:73/230 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 TNSICCAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAM-QCQNGHLLCVDC--------RIR 171
            :|::|||                       || :.:...|| |||.|||:|..|        |:|
  Fly   108 SNALCCA-----------------------VC-LDLPKTAMYQCQMGHLMCAACFTHLLADGRLR 148

  Fly   172 SE--RCPVCR---DFYTPRRALLAEQIFLTIANAFEMCRSE----NKLRQKLFAGITRPVVGRQD 227
            .:  .||.||   ...|..|.|..|:....:.:..:.|..|    :..|.:......||...:..
  Fly   149 DQIATCPNCRVEISKSTASRNLAVEKAASELPSECQFCNKEFPYKSLERHEQHECQERPTKCKYH 213

  Fly   228 RITGQDTWRKRRPVLPTNKFLTKLLEGCAYSTDNLSPSNAATLLRTNTTDVAGDSSEIPARTSPV 292
            ||..|  |  |.|...||:          :..:.|.|..:              ..|:.|.....
  Fly   214 RIGCQ--W--RGPYHETNE----------HERNCLHPQKS--------------GYEVMAALEAH 250

  Fly   293 TATPPERTTMHATLDANAAHPSLSTNDLQQEGVKP 327
            .....|...|..||....::..:..||||   :||
  Fly   251 DDRIKEEKKMFNTLIDLLSYEKIIFNDLQ---MKP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 22/78 (28%)
Sina 168..>232 CDD:302762 16/77 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.