DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and Fife

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001261340.1 Gene:Fife / 38337 FlyBaseID:FBgn0264606 Length:1314 Species:Drosophila melanogaster


Alignment Length:205 Identity:46/205 - (22%)
Similarity:80/205 - (39%) Gaps:50/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 RSENKLRQKLFAGITRPVVGRQDRI-TGQDTWRKRRPVLPTNKFLTKLLEGCAYSTDNLSPSNAA 268
            :.:..|:|:|..|     ||..|.. ..:|..::.||          ..:|........||..|.
  Fly   986 QQQQYLQQQLPMG-----VGNADTSPPSEDEDKRYRP----------RWKGSVSQLPPQSPKQAL 1035

  Fly   269 TLLR--TNTTDVAGDSSEIPARTSPVTATPP---ERTTMHATLDANAAHPSLSTNDLQQEGVKPN 328
            :.|:  .:.::||.|:.    |...:..|.|   .:::|....::.|:.|:.:|..||::|....
  Fly  1036 SRLKQAASASNVAQDTQ----RQGQLLTTNPLQQRKSSMFQLGESQASPPTTTTTHLQRKGSMYV 1096

  Fly   329 AEGVDEESGTNSSHISATSLHGPPLPASVSPGINESSGLQ--PVRIPPVTPSQDLPQQ---VVQT 388
            |:            ::.|..||.|        ..:.|..|  .|.:...:|..|.||:   ||:|
  Fly  1097 AK------------VTETPPHGTP--------TRKGSVYQRSVVGLSVDSPGADSPQRKQSVVKT 1141

  Fly   389 KPASLLYRCP 398
            ...|.:..||
  Fly  1142 LSGSYVNICP 1151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
FifeNP_001261340.1 FYVE_BSN_PCLO 130..187 CDD:277290
PDZ_signaling 491..580 CDD:238492
DegQ <526..577 CDD:223343
C2A_RIM1alpha 651..779 CDD:175997
C2 1163..1304 CDD:301316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.