DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and CG43707

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001260005.1 Gene:CG43707 / 33601 FlyBaseID:FBgn0263846 Length:2021 Species:Drosophila melanogaster


Alignment Length:244 Identity:56/244 - (22%)
Similarity:83/244 - (34%) Gaps:69/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 EMCRSENKLRQKLFAGITRPVVGRQDRITGQDTWRKRRPVLPTNKFL------TKLLEGCAYSTD 260
            :|.|...|:|::|...      .|:|.:......|.|  ..||...|      |:||...:.||.
  Fly  1265 KMKRFRPKIRRQLRKS------SREDVLAAAAVRRSR--ATPTIFGLSSGSGDTELLLDASMSTG 1321

  Fly   261 NLSPSNAATLLRTNTTDVAGDS--SEIPARTSPVTATPPERTTMHATLDANAAHPSLSTNDLQQE 323
            .::.:..:.:     |.|:..|  |::|...|.|| |.||...  |.|.|...|...:...|...
  Fly  1322 AVAGTTTSAV-----TSVSAPSSASKLPTSESSVT-TQPEAVV--APLPAKKPHSCATPTSLLSP 1378

  Fly   324 GVKPNAEGVDEESGTNSSHISATSLHGPPLPASVSPG---------------------------- 360
            .: |...|...:|.:::..:.|.|:..   ..|||||                            
  Fly  1379 KL-PTTSGTQSKSTSDTFQLKAKSIES---LRSVSPGSDSVFYSEADGNAASGEQSHCHHCGKEM 1439

  Fly   361 --------INESSGLQPVRIP-----PVTPSQDLPQQVVQTKPASLLYR 396
                    |:|.:|.....||     .|.|..|.....|.||....||:
  Fly  1440 EGKQQSNTISELAGDSVESIPYIEQDIVKPPSDFADSPVTTKTTQRLYK 1488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
CG43707NP_001260005.1 PHA03369 <987..1394 CDD:223061 36/145 (25%)
PDZ_signaling 1702..1775 CDD:238492
PH 1792..1894 CDD:278594
PH-like 1792..1893 CDD:302622
PH-like 1911..2011 CDD:302622
PH 1921..2014 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.