DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and Pard3b

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001178737.1 Gene:Pard3b / 301455 RGDID:1584992 Length:1203 Species:Rattus norvegicus


Alignment Length:410 Identity:77/410 - (18%)
Similarity:110/410 - (26%) Gaps:165/410 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GFHSTSNEDGQHGDGSSVRLLRIPRAAPAMENYGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPG 71
            ||...:.:...||.|.......:|:.|...:.                            .|:.|
  Rat   394 GFTVVTRDSSIHGPGPIFVKNILPKGAAVKDG----------------------------RLQSG 430

  Fly    72 DCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLE 136
            |.:|||||.||.|....|:..|::|.|...|:                            |||:.
  Rat   431 DRILEVNGRDVTGRTQEELVAMLRSTKQGETV----------------------------SLVIA 467

  Fly   137 SILRLVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRALLAEQIFLTIANAF 201
            .                     |.|..|                   ||........:.....:.
  Rat   468 R---------------------QEGSFL-------------------PRELKGEPDCYALSLESS 492

  Fly   202 EMCRSENKLRQKLFAGITRPVVGRQDRITGQDTWRKRRPVLPTNKFLTKLLEGCAYSTDNLSPSN 266
            |....|..|.....||:...:.|.:.|.||.|          ...|:..::.|.|...|.     
  Rat   493 EQLTLEIPLNDSGSAGLGVSLKGNKSRETGTD----------LGIFIKSIIHGGAAFKDG----- 542

  Fly   267 AATLLRTNTTDVAGDSSEIPARTSPVTATPPERTTMHATLDANAAHPSLST--NDLQQEGVKPNA 329
               .||.|...:|.:..                     ||...:.|.::.|  ..:..||   |.
  Rat   543 ---RLRMNDQLIAVNGE---------------------TLLGKSNHEAMETLRRSMSMEG---NI 580

  Fly   330 EGVDEESGTNSSHISATSLHGPPLPASVSPGINESSGLQPVRIPPVTPSQDLPQQVV---QTKPA 391
            .|:          |....|.....|..   .|:|...|.       .|..:..|:.:   :...:
  Rat   581 RGM----------IQLVILRRLERPLE---EISECGALS-------RPCFENCQEALSASRRNDS 625

  Fly   392 SLLYRCPCKLQDPQDPAKDL 411
            ||||  ||....|||..|||
  Rat   626 SLLY--PCGTYSPQDKRKDL 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 18/79 (23%)
Pard3bNP_001178737.1 DUF3534 1..143 CDD:288873
PDZ_signaling 201..288 CDD:238492
PDZ 380..469 CDD:214570 26/151 (17%)
PDZ_signaling 501..589 CDD:238492 25/139 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.