DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and Slc9a3r1

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_036160.1 Gene:Slc9a3r1 / 26941 MGIID:1349482 Length:355 Species:Mus musculus


Alignment Length:106 Identity:31/106 - (29%)
Similarity:47/106 - (44%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DGQHGDGSSVRLLRIPRAAPAME---NYGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPGDCVLE 76
            |....:.|.:|.|| ||.....:   .|||.|...|..|..::..|...:||...||:..|.::|
Mouse   133 DQNEAEKSHLRELR-PRLCTMKKGPNGYGFNLHSDKSKPGQFIRAVDPDSPAEASGLRAQDRIVE 196

  Fly    77 VNGNDVLGLRVSEIAKMVKSQKDCVTILCWNSECD---KDC 114
            |||..:.|.:..::...:|...|...:|..:.|.|   |.|
Mouse   197 VNGVCMEGKQHGDVVSAIKGGGDEAKLLVVDKETDEFFKKC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 24/82 (29%)
Slc9a3r1NP_036160.1 PDZ_signaling 12..91 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..146 3/12 (25%)
PDZ_signaling 147..226 CDD:238492 22/78 (28%)
EBP50_C 230..355 CDD:286142 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14191
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.