DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and PDZD2

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_005248326.1 Gene:PDZD2 / 23037 HGNCID:18486 Length:2873 Species:Homo sapiens


Alignment Length:438 Identity:87/438 - (19%)
Similarity:136/438 - (31%) Gaps:134/438 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GSSVRLLR-IPRAAPAMENYGFQLTRS----KWDPYPWVCEVAAGTPAA-----------LCGLK 69
            ||||.|.. ||.......:|...||.|    |..|..|..:..:|:.:|           .....
Human  1036 GSSVDLEESIPEGMVDAASYAANLTDSAEAPKGSPGSWWKKELSGSSSAPKLEYTVRTDTQSPTN 1100

  Fly    70 PGDCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTILCWNSECD----------------KDCDTNS 118
            .|........::.||.|...:|:        |:..|..||.:                ..||.:|
Human  1101 TGSPSSPQQKSEGLGSRHRPVAR--------VSPHCKRSEAEAKPSGSQTVNLTGRANDPCDLDS 1157

  Fly   119 ICCAPMPTSLRRL--------SLVLESILRLVECPVCGVTISPPAMQCQNGHLLC-VDCRIRSER 174
            ...|   ||::..        ::..||:.:|.....|..|      .|:....|. :|....:|.
Human  1158 RVQA---TSVKVTVAGFQPGGAVEKESLGKLTTGDACVST------SCELASALSHLDASHLTEN 1213

  Fly   175 CPVCRDFYTPRRALLAEQIFLTIANAFEMCRSENKLRQKLFAGITRPVVGRQDRITGQDTWRKRR 239
            .|       ...:.|.:|....:.::.::..|..|      .|...|...:....|||.: |...
Human  1214 LP-------KAASELGQQPMTELDSSSDLISSPGK------KGAAHPDPSKTSVDTGQVS-RPEN 1264

  Fly   240 PVLPTNKFLTKLLEGCAYSTDNLSPSNAATLLRTNTTDVAGDSSEIPARTSP----VTATPPERT 300
            |..|.:..:||    |.                      |.....:|...||    ..|.||:.:
Human  1265 PSQPASPRVTK----CK----------------------ARSPVRLPHEGSPSPGEKAAAPPDYS 1303

  Fly   301 TMHATLDANAAHPSLSTNDLQQEGVKPNAEGV---------------DEESGTNSSHISA---TS 347
            ...:..:.:..|.:.....|:  |..|.|||:               ::..|...:|..|   |.
Human  1304 KTRSASETSTPHNTRRVAALR--GAGPGAEGMTPAGAVLPGDPLTSQEQRQGAPGNHSKALEMTG 1366

  Fly   348 LHGPPLPASVSPGINESSGLQPVRIPPVT----PSQDLPQQVVQTKPA 391
            :|.|  .:|..|.:.|.:.....|.|..:    ||.|      .||.|
Human  1367 IHAP--ESSQEPSLLEGADSVSSRAPQASLSMLPSTD------NTKEA 1406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 19/95 (20%)
PDZD2XP_005248326.1 PDZ_signaling 335..416 CDD:238492
PDZ_signaling 589..670 CDD:238492
PDZ_signaling 726..810 CDD:238492
PDZ_signaling 2623..2694 CDD:238492
PDZ 2785..2867 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.