DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and Siah2

DIOPT Version :10

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_033200.2 Gene:Siah2 / 20439 MGIID:108062 Length:325 Species:Mus musculus


Alignment Length:54 Identity:26/54 - (48%)
Similarity:32/54 - (59%) Gaps:1/54 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPR-RALLAEQI 193
            |.|||||...:.||.:|||.|||:|..||.:...||.||...||. |.|..|::
Mouse    78 LFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKV 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948
RING-HC_SIAHs 143..179 CDD:438233 18/35 (51%)
Siah2NP_033200.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
RING-HC_SIAH2 76..126 CDD:438410 24/47 (51%)
Sina 123..319 CDD:460824 3/9 (33%)
SBD. /evidence=ECO:0000250|UniProtKB:P61092 131..323 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.