powered by:
Protein Alignment CG6688 and F20D6.1
DIOPT Version :9
Sequence 1: | NP_651110.1 |
Gene: | CG6688 / 42716 |
FlyBaseID: | FBgn0039038 |
Length: | 424 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505110.2 |
Gene: | F20D6.1 / 184722 |
WormBaseID: | WBGene00017633 |
Length: | 180 |
Species: | Caenorhabditis elegans |
Alignment Length: | 43 |
Identity: | 15/43 - (34%) |
Similarity: | 20/43 - (46%) |
Gaps: | 2/43 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 381 LPQQVVQTKPASLLYRCPCKLQDPQDPAKDLHQNCCYKSAFRL 423
|||.|:||..|.|.|.......:|....|...:: |.||.|:
Worm 107 LPQDVIQTCTARLAYHNKHGFAEPTPIFKGYTKD--YSSAGRV 147
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6688 | NP_651110.1 |
PDZ_signaling |
24..104 |
CDD:238492 |
|
F20D6.1 | NP_505110.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.