DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and C46H11.6

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_491502.1 Gene:C46H11.6 / 183523 WormBaseID:WBGene00016730 Length:342 Species:Caenorhabditis elegans


Alignment Length:215 Identity:47/215 - (21%)
Similarity:82/215 - (38%) Gaps:62/215 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 NKFLTKLLEGCAYSTD-----NLSPS-------NAATLLRTNTTDV--AGDSSEIPARTSPVTAT 295
            :|:.|:|::|...|.:     |:.|:       :...|.|.||..|  ...:|.:.:.|..||.|
 Worm    86 SKYQTELMKGETCSVEVTRRKNIIPATRERLKKSGCVLRRDNTCFVIEVEKTSAMKSATVGVTVT 150

  Fly   296 PPERTTMHATLDANAAHPSLST---------NDLQQEGVKPNAEGVDEESGTNSSHISATSLHGP 351
            ..::..:...::.:    ||::         .|:.:|.:. |||..|:......|.|    |.|.
 Worm   151 YIQKRGIVTRIEPS----SLASIFFGRGDLIMDINEESIL-NAEKNDDFIREKLSGI----LKGE 206

  Fly   352 PL------PASVSPGINESSGLQPVRIPPVTPSQDLPQQ-----------------VVQTKPASL 393
            .:      |.||     ||:......|..|.|..|:...                 :.:.:|.|:
 Worm   207 KVTFLVERPVSV-----ESANTLRHLIESVAPDPDVKMANDAICIGRNASNMHYNVLKKLQPKSI 266

  Fly   394 LYRCPCKLQDPQD--PAKDL 411
            |.|...|.::|::  |.|.|
 Worm   267 LSRDVFKGKNPREKKPGKKL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
C46H11.6NP_491502.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.