DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and nrfl-1

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_741479.1 Gene:nrfl-1 / 177736 WormBaseID:WBGene00006438 Length:608 Species:Caenorhabditis elegans


Alignment Length:353 Identity:70/353 - (19%)
Similarity:121/353 - (34%) Gaps:90/353 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RLLRIPRAAPAMENYGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGN---DVLGLR 86
            ||..:.:..|..| :||.|...:...: ::..|.||......||:.|..::.|||.   ...|.:
 Worm   283 RLAELNKGTPDQE-FGFNLHAERGRGH-FIGTVDAGGIGEKAGLEAGQRIVGVNGQLIYPTTGHK 345

  Fly    87 VSEIAKMVKSQKDCVTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGV-- 149
              |:..::|......|:|..:.:.||....::|..:            .:::.|:...||..|  
 Worm   346 --EVVALIKKDTMKTTLLVASEDVDKYHKDHNIAYS------------WDNVERVDTRPVINVET 396

  Fly   150 -----TISPPAMQCQNGH----LLCVDCRIRSERCPVCRDFYTPRRALLAEQIFLTIAN---AFE 202
                 .:|.|.   .||:    |.....::..|| .:.:...|.|..        ||.|   |::
 Worm   397 HHHHEEVSVPK---SNGYDVPPLNPHSIQVNEER-EISKMTTTTRTE--------TITNSNSAYQ 449

  Fly   203 MCRS-------------ENKLRQKLFAGITRPVVGRQDRITGQDTWRKRRPVLPTNKFLTKLLEG 254
            ...|             .|.|..::|..:..|.|          |......|||           
 Worm   450 YKESSTAYDAYATPPVDSNDLMDEVFGRVNLPGV----------TMSSHTEVLP----------- 493

  Fly   255 CAYSTDNLSPSNAATLLRTNTTDVAGDSSEIPARTSPVTATPPERTTMHATLDANAAH--PSLST 317
               .||::|..::.:..|.:..||......:|   |..|.:..:......|...:..|  ||..:
 Worm   494 ---PTDDISSVSSLSSHRESAVDVPVSHQYVP---SYATESHQKHEQHSQTHHHHHQHQQPSPLS 552

  Fly   318 NDLQQEGVKPNAEGVDEESGTNSSHISA 345
            |.........:..|.|::   :..|:||
 Worm   553 NGSSHGYAASSTSGYDDD---DIYHLSA 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 20/81 (25%)
nrfl-1NP_741479.1 PDZ_signaling 282..363 CDD:238492 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14191
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.