DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and siah-1

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_500409.1 Gene:siah-1 / 177138 WormBaseID:WBGene00021369 Length:419 Species:Caenorhabditis elegans


Alignment Length:208 Identity:51/208 - (24%)
Similarity:78/208 - (37%) Gaps:64/208 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HSTSN---ED-GQHGDGSSVRLLRIPRAAPAMENYGFQLTRSKWDPYPWVCEVAAGTPAALCGLK 69
            |.|||   || ..|.:|:.      |...|.       :|:.:       |::.. ||.  ....
 Worm    47 HQTSNSLVEDMVNHSNGNP------PPVPPG-------ITQQQ-------CQIGL-TPR--MSAS 88

  Fly    70 PGDCVLEVNGNDVLGLRVSEI---------------AKMVKSQKDCVTILCWNSECDKDCDTNSI 119
            |...|..::|..|||..::.:               |:.::|....:.|....:..|...:    
 Worm    89 PPSAVSTISGTAVLGKTMARVQSNPPGSIPHNTTTTAQGIQSVAPHIPIGGGGATDDSSAE---- 149

  Fly   120 CCAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTP 184
                              ||.:.|||||...:.||.|||.:|||:|.:||.:.:.||.||.....
 Worm   150 ------------------ILSVFECPVCLEYMLPPYMQCSSGHLVCSNCRPKLQCCPTCRGPTPS 196

  Fly   185 RRALLAEQIFLTI 197
            .|.|..|:|..|:
 Worm   197 VRNLGLEKIANTV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 14/94 (15%)
siah-1NP_500409.1 RING 155..194 CDD:238093 20/38 (53%)
Sina 197..396 CDD:281181 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.