DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6688 and gras-1

DIOPT Version :9

Sequence 1:	NP_651110.1	Gene:	CG6688 / 42716	FlyBaseID:	FBgn0039038	Length:	424	Species:	Drosophila melanogaster
Sequence 2:	NP_492164.1	Gene:	gras-1 / 172549	WormBaseID:	WBGene00009272	Length:	245	Species:	Caenorhabditis elegans

Alignment Length:	141	Identity:	34/141 - (24%)
Similarity:	61/141 - (43%)	Gaps:	41/141 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    35 AMENYGFQLTRS-KWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQK 98
            |:::|.|:.|.| .::...:|..|:|.:||..||:..||.|:.||...|:   .:..|::|:|..
Worm    72 ALQSYVFKRTSSNSYERITYVDYVSADSPADRCGITRGDMVIAVNEKSVV---TASHAEIVESIA 133

  Fly    99 DCVTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNGHL 163
            .|:.:                          .|.||.:.:.|:||       :|..::|.:
Worm   134 QCLQV--------------------------SLVLVFKDVARIVE-------LSMRSIQLR---- 161

  Fly   164 LCVDCRIRSER 174
            ..:|.:||..|
Worm   162 FMLDAKIRELR 172

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6688	NP_651110.1	PDZ_signaling	24..104	CDD:238492	22/69 (32%)
gras-1	NP_492164.1	PDZ	67..145	CDD:238080	25/101 (25%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900