DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and smz-2

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_491965.1 Gene:smz-2 / 172415 WormBaseID:WBGene00020661 Length:274 Species:Caenorhabditis elegans


Alignment Length:219 Identity:48/219 - (21%)
Similarity:82/219 - (37%) Gaps:47/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 RIRSERCPVCRDFYTPRRALLAEQIFLTIANAFEMCRSENKLRQKLFAGITRP-----VVGRQDR 228
            ::..:.|..|.||:   |||.    |........:.|.|.| .::|.|.:..|     ::.|::.
 Worm    50 KVNGQNCKDCNDFF---RALR----FAAPCAKITVNRDEKK-AEELEARVHIPEDRAKIIQRREG 106

  Fly   229 IT---GQDTWRKRRPVLP------TNKFLT------KLLEGCAYSTDNLSPSNAATLLRTNTTDV 278
            ..   ....|.:..|.|.      .|:.|.      .|.|.|....|:|...:.   :..:..||
 Worm   107 YVYELATLVWVQNGPKLGLGIKHFQNRVLVSRVDPGSLAEKCLVLGDHLCDVDG---IPVSDKDV 168

  Fly   279 AGD----SSEIPARTSPVTATPPERTTMHATLDANA-AHPSLSTNDLQQEGVKPNAEGVDEESGT 338
            |.|    :.:...:.:.|...|.       ::||.. |..:|:||.:|...|:.|    ::..|.
 Worm   169 ARDLLVKNIQEKGKVTFVVERPD-------SIDAKQWAKQALATNLMQPPSVQMN----EDVKGI 222

  Fly   339 NSSHISATSLHGPPLPASVSPGIN 362
            .|.:..|.....||..:::|.|.|
 Worm   223 ASQYRQALPGLKPPAKSAMSTGPN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
smz-2NP_491965.1 PDZ_signaling 7..77 CDD:238492 8/33 (24%)
PDZ_signaling 114..188 CDD:238492 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.