DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and TAMALIN

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_859062.1 Gene:TAMALIN / 160622 HGNCID:18707 Length:395 Species:Homo sapiens


Alignment Length:68 Identity:22/68 - (32%)
Similarity:36/68 - (52%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ENYGFQL--------TRSKWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKM 93
            :.:||::        ...:.:...:||.|...:||.|.||.|||.:..|||.:|.|:|..||..:
Human   110 QTFGFEIQTYGLHHREEQRVEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDI 174

  Fly    94 VKS 96
            :|:
Human   175 IKA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 22/68 (32%)
TAMALINNP_859062.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
PDZ_signaling 100..185 CDD:238492 22/68 (32%)
Interaction with PSCD3. /evidence=ECO:0000250 181..258
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.